Antibodies

View as table Download

Rabbit Polyclonal Anti-GNAZ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAZ antibody: synthetic peptide directed towards the N terminal of human GNAZ. Synthetic peptide located within the following region: LIIYNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEIT

Rabbit Polyclonal Anti-Gz-alpha Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Gz-alpha Antibody: A synthesized peptide derived from human Gz-alpha

Rabbit polyclonal Gz-a (Ab-16) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Gz-a around the phosphorylation site of serine 16 (R-R-SP-R-R).

Anti-GNAZ Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human guanine nucleotide binding protein (G protein), alpha z polypeptide

Anti-GNAZ Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 4-18 amino acids of Human guanine nucleotide binding protein (G protein), alpha z polypeptide