Rabbit anti-LIPC Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human LIPC |
Rabbit anti-LIPC Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human LIPC |
LIPC (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 310-338 amino acids from the Central region of Human LIPC / Hepatic lipase |
Rabbit Polyclonal Anti-LIPF Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LIPF antibody: synthetic peptide directed towards the N terminal of human LIPF. Synthetic peptide located within the following region: ISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKNSGNTGQRPVVFLQH |
Rabbit polyclonal antibody to Pancreatic Lipase (pancreatic lipase)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 21 and 300 of Pancreatic Lipase (Uniprot ID#P16233) |
Rabbit Polyclonal Anti-PNLIP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PNLIP antibody: synthetic peptide directed towards the C terminal of human PNLIP. Synthetic peptide located within the following region: SGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQ |
LIPC (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 16-44 amino acids from the N-terminal region of Human LIPC / Hepatic lipase |
Rabbit Polyclonal Antibody against Endothelial Lipase
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A C-terminal synthetic peptide made to the human endothelial lipase protein sequence. |
Rabbit Polyclonal Antibody against Endothelial Lipase
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | An N-terminal synthetic peptide made to the human endothelial lipase protein sequence. |
Rabbit Polyclonal Anti-PNLIP Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PNLIP antibody: synthetic peptide directed towards the C terminal of human PNLIP. Synthetic peptide located within the following region: GHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILV |
Pancreatic Lipase (PNLIP) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 311-341 amino acids from the C-terminal region of human Pancreatic lipase / PNLIP |
Anti-LIPC Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 220 amino acids of human lipase, hepatic |
Rabbit Polyclonal Anti-LIPC Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LIPC antibody is: synthetic peptide directed towards the C-terminal region of LIPC. Synthetic peptide located within the following region: LKTIRVKAGETQQRMTFCSENTDDLLLRPTQEKIFVKCEIKSKTSKRKIR |
Rabbit Polyclonal Anti-PNLIP Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PNLIP |
LIPC Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |