Pancreatic Lipase (PNLIP) Rabbit Polyclonal Antibody

CAT#: TA334301

Rabbit Polyclonal Anti-PNLIP Antibody

Product Images

WB Suggested Anti-PNLIP Antibody Titration: 1.25 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PNLIP antibody: synthetic peptide directed towards the C terminal of human PNLIP. Synthetic peptide located within the following region: SGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: pancreatic lipase
• Database Link:
  NP_000927
  Entrez Gene 5406 Human
  UniProt ID P16233
• Background: PNLIP is a member of the lipase gene family. It encodes a carboxyl esterase that hydrolyzes insoluble, emulsified triglycerides, and is essential for the efficient digestion of dietary fats. This gene is expressed specifically in the pancreas.
• Synonyms: PL; PNLIPD; PTL
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 92%; Dog: 86%; Pig: 86%; Horse: 85%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Glycerolipid metabolism, Metabolic pathways