Antibodies

View as table Download

Rabbit polyclonal NFYB Antibody (N-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NFYB antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 17-46 amino acids from the N-terminal region of human NFYB.

Rabbit Polyclonal anti-NFYB antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFYB antibody: synthetic peptide directed towards the middle region of human NFYB. Synthetic peptide located within the following region: EAMKGEKGIGGAVTATDGLSEELTEEAFTNQLPAGLITTDGQQQNVMVYT

Rabbit Polyclonal Anti-NFYB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFYB antibody: synthetic peptide directed towards the N terminal of human NFYB. Synthetic peptide located within the following region: MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKE