NFYB Rabbit Polyclonal Antibody

CAT#: TA329232

Rabbit Polyclonal anti-NFYB antibody

Product Images

WB Suggested Anti-NFYB Antibody Titration: 0.2-1 ug/ml; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NFYB antibody: synthetic peptide directed towards the middle region of human NFYB. Synthetic peptide located within the following region: EAMKGEKGIGGAVTATDGLSEELTEEAFTNQLPAGLITTDGQQQNVMVYT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: nuclear transcription factor Y subunit beta
• Database Link:
  NP_006157
  Entrez Gene 4801 Human
  UniProt ID P25208
• Background: NFYB is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoter regions in a variety of genes. This gene product, subunit B, forms a tight dimer with the C subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Observation of the histone nature of these subunits is supported by two types of evidence; protein sequence alignments and experiments with mutants.
• Synonyms: CBF-A; CBF-B; HAP3; NF-YB
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Horse: 93%; Bovine: 93%; Yeast: 91%; Guinea pig: 86%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Antigen processing and presentation