Antibodies

View as table Download

Rabbit Polyclonal Anti-SDHB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SDHB antibody: synthetic peptide directed towards the middle region of human SDHB. Synthetic peptide located within the following region: YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAE

Rabbit Polyclonal antibody to SDHB (succinate dehydrogenase complex, subunit B, iron sulfur (Ip))

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 221 and 280 of SDHB (Uniprot ID#P21912)

Rabbit Polyclonal Anti-SDHB Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SDHB