Antibodies

Jump to Filters
View as table Download
Ap1s1 Rabbit Polyclonal Antibody
TA331243

USD 375.00

5 Days

Rabbit Polyclonal Anti-Ap1s1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ap1s1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ap1s1. Synthetic peptide located within the following region: VCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQEEDES
AP1S1 Rabbit Polyclonal Antibody
TA373558

USD 220.00

3 Weeks

AP1S1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human AP1S1 (NP_001274.1).
Modifications Unmodified