Ap1s1 Rabbit Polyclonal Antibody

CAT#: TA331243

Rabbit Polyclonal Anti-Ap1s1 Antibody

Product Images

Host: Rabbit; Target Name: Ap1s1; Sample Tissue: Mouse Heart lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Ap1s1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ap1s1. Synthetic peptide located within the following region: VCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQEEDES
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 19 kDa
• Gene Name: adaptor protein complex AP-1, sigma 1
• Database Link:
  NP_031483
  Entrez Gene 11769 Mouse
  UniProt ID P61967
• Background: Ap1s1 is a subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.
• Synonyms: AP19; CLAPS1; FLJ92436; OTTHUMP00000211468; SIGMA1A; Sigma1A-adaptin; WUGSC:H_DJ0747G18.2
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%