APPBP1 rabbit polyclonal  antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NAE1 (APPBP1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 430-459 amino acids from the C-terminal region of human NAE1 (APPBP1). |
Rabbit Polyclonal Anti-NAE1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Nae1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Nae1. Synthetic peptide located within the following region: ARALKEFVAKEGQGNLPVRGTIPDMIADSNKYIKLQNVYREKAKKDAAAV |
Rabbit Polyclonal Anti-NAE1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NAE1 |
Germany
Japan
United Kingdom
China
