Rabbit Polyclonal Anti-ERD23 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ERD23 Antibody: A synthesized peptide derived from human ERD23 |
Rabbit Polyclonal Anti-ERD23 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ERD23 Antibody: A synthesized peptide derived from human ERD23 |
Rabbit Polyclonal Anti-KDELR3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KDELR3 antibody: synthetic peptide directed towards the middle region of human KDELR3. Synthetic peptide located within the following region: AYVTVYMIYGKFRKTFDSENDTFRLEFLLVPVIGLSFLENYSFTLLEILW |