KDELR3 Rabbit Polyclonal Antibody
Other products for "KDELR3"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-KDELR3 antibody: synthetic peptide directed towards the middle region of human KDELR3. Synthetic peptide located within the following region: AYVTVYMIYGKFRKTFDSENDTFRLEFLLVPVIGLSFLENYSFTLLEILW |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 25 kDa |
Gene Name | KDEL endoplasmic reticulum protein retention receptor 3 |
Database Link | |
Background | This gene encodes a member ofThe KDEL endoplasmic reticulum protein retention receptor family. Retention of resident soluble proteins inThe lumen ofThe endoplasmic reticulum (ER) is achieved in both yeast and animal cells byTheir continual retrieval fromThe cis-Golgi, or a pre-Golgi compartment. Sorting ofThese proteins is dependent on a C-terminal tetrapeptide signal, usually lys-asp-glu-leu (KDEL) in animal cells, and his-asp-glu-leu (HDEL) in S. cerevisiae.This process is mediated by a receptor that recognizes, and bindsThe tetrapeptide-containing protein, and returns it toThe ER. In yeast,The sorting receptor encoded by a single gene, ERD2, is a seven-transmembrane protein. Unlike yeast, several human homologs ofThe ERD2 gene, constitutingThe KDEL receptor gene family, have been described. KDELR3 wasThe third member ofThe family to be identified. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Synonyms | ERD2L3 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Guinea pig: 93%; Mouse: 92% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Vibrio cholerae infection |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.