Antibodies

View as table Download

Rabbit Polyclonal Anti-ERD23 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ERD23 Antibody: A synthesized peptide derived from human ERD23

KDELR3 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse

Rabbit Polyclonal Anti-KDELR3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KDELR3 antibody: synthetic peptide directed towards the middle region of human KDELR3. Synthetic peptide located within the following region: AYVTVYMIYGKFRKTFDSENDTFRLEFLLVPVIGLSFLENYSFTLLEILW