Antibodies

View as table Download

Rabbit Polyclonal Anti-DDAH2 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DDAH2 antibody: synthetic peptide directed towards the N terminal of human DDAH2. Synthetic peptide located within the following region: MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGG

Rabbit Polyclonal Anti-DDAH2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human DDAH2

DDAH2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-285 of human DDAH2 (NP_039268.1).
Modifications Unmodified