DDAH2 Rabbit Polyclonal Antibody

CAT#: TA344265

Rabbit Polyclonal Anti-DDAH2 Antibody - N-terminal region

Product Images

WB Suggested Anti-DDAH2 Antibody Titration: 1 ug/ml; Positive Control: Fetal Brain Lysate

• 

  Immunohistochemistry with Human Uterus lysate tissue at an antibody concentration of 5.0 ug/ml using anti-DDAH2 antibody

• 

  Human Uterus

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DDAH2 antibody: synthetic peptide directed towards the N terminal of human DDAH2. Synthetic peptide located within the following region: MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: dimethylarginine dimethylaminohydrolase 2
• Database Link:
  NP_039268
  Entrez Gene 51793 MouseEntrez Gene 23564 Human
  UniProt ID O95865
• Background: DDAH2 hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. DDAH2 has therefore a role in nitric oxide generation.This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: DDAH; DDAHII; G6a; HEL-S-277; NG30
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 93%; Rabbit: 79%