Rabbit Polyclonal Anti-CALCOCO1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CALCOCO1 antibody: synthetic peptide directed towards the N terminal of human CALCOCO1. Synthetic peptide located within the following region: ESTTDGSPIHTSVQFQASYLPKPGAQLYQFRYVNRQGQVCGQSPPFQFRE |
CALCOCO1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CALCOCO1 |
CALCOCO1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 462-691 of human CALCOCO1 (NP_065949.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China