Antibodies

Jump to Filters
View as table Download
CD200R (CD200R1) Rabbit Polyclonal Antibody
TA316101

USD 345.00

In Stock

Rabbit polyclonal anti-CD200R1 (MOX2R) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MOX2R.
CD200R (CD200R1) Rabbit Polyclonal Antibody
TA342750

USD 375.00

5 Days

Rabbit Polyclonal Anti-CD200R1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD200R1 antibody: synthetic peptide directed towards the N terminal of human CD200R1. Synthetic peptide located within the following region: NLIIITWEIILRGQPSCTKAYKKETNETKETNCTDERITWVSRPDQNSDL
CD200R (CD200R1) Rabbit Polyclonal Antibody
TA374422

USD 220.00

3 Weeks

CD200R1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 249-348 of human CD200R1 (NP_620161.1).
Modifications Unmodified