Antibodies

Jump to Filters
View as table Download
CHM Rabbit Polyclonal Antibody
TA330419

USD 375.00

5 Days

Rabbit Polyclonal Anti-CHM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHM antibody: synthetic peptide directed towards the N terminal of human CHM. Synthetic peptide located within the following region: LHVDSRSYYGGNWASFSFSGLLSWLKEYQENSDIVSDSPVWQDQILENEE
CHM Rabbit Polyclonal Antibody
TA374744

USD 220.00

3 Weeks

CHM Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 120-210 of human CHM (NP_000381.1).
Modifications Unmodified