CHM Rabbit Polyclonal Antibody

CAT#: TA330419

Rabbit Polyclonal Anti-CHM Antibody

Product Images

WB Suggested Anti-CHM Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: Human Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CHM antibody: synthetic peptide directed towards the N terminal of human CHM. Synthetic peptide located within the following region: LHVDSRSYYGGNWASFSFSGLLSWLKEYQENSDIVSDSPVWQDQILENEE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 73 kDa
• Gene Name: CHM, Rab escort protein 1
• Database Link:
  NP_000381
  Entrez Gene 1121 Human
  UniProt ID P24386
• Background: CHM binds unprenylated Rab proteins, presents it to the catalytic Rab GGTase dimer, and remains bound to it after the geranylgeranyl transfer reaction. The component A is thought to be regenerated by transferring its prenylated Rab back to the donor membrane.The choroideremia gene encodes for a protein, the Rab escort protein-1 (REP1), which is involved in membrane trafficking. [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: DXS540; GGTA; HSD-32; REP-1; TCD
• Note: Immunogen sequence homology: Human: 100%; Horse: 80%

Reference Data

• Protein Families: Druggable Genome