Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Anti-REP1 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1-80 aa at the N-terminus of rat Rep1 produced in E. coli. |
Goat Polyclonal Anti-REP1 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1-80 aa at the N-terminus of rat Rep1 produced in E. coli. |
Goat Polyclonal Anti-REP1 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 617 aa - stop at the C-terminus of human Rep1 produced in E. coli. |
Goat Polyclonal Anti-REP1 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 617 aa - stop at the C-terminus of human Rep1 produced in E. coli. |
Rabbit Polyclonal Anti-CHM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHM antibody: synthetic peptide directed towards the N terminal of human CHM. Synthetic peptide located within the following region: LHVDSRSYYGGNWASFSFSGLLSWLKEYQENSDIVSDSPVWQDQILENEE |
CHM rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CHM |
CHM Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 120-210 of human CHM (NP_000381.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CHM