Antibodies

View as table Download

CHM rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CHM
CHM

USD 300.00

In Stock

Goat Polyclonal Anti-REP1 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 1-80 aa at the N-terminus of rat Rep1 produced in E. coli.
CHM

USD 450.00

In Stock

Goat Polyclonal Anti-REP1 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 1-80 aa at the N-terminus of rat Rep1 produced in E. coli.
CHM

USD 320.00

In Stock

Goat Polyclonal Anti-REP1 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 617 aa - stop at the C-terminus of human Rep1 produced in E. coli.
CHM

USD 450.00

In Stock

Goat Polyclonal Anti-REP1 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 617 aa - stop at the C-terminus of human Rep1 produced in E. coli.

Rabbit Polyclonal Anti-CHM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHM antibody: synthetic peptide directed towards the N terminal of human CHM. Synthetic peptide located within the following region: LHVDSRSYYGGNWASFSFSGLLSWLKEYQENSDIVSDSPVWQDQILENEE

CHM rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CHM

CHM Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 120-210 of human CHM (NP_000381.1).
Modifications Unmodified