Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Collagen I (COL1A1) rabbit polyclonal antibody, Biotin
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
| Conjugation | Biotin |
| Immunogen | Collagen Type I from Human and Bovine placenta. |
Rabbit Polyclonal Anti-COL1A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL1A1 antibody: synthetic peptide directed towards the C terminal of human COL1A1. Synthetic peptide located within the following region: PPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKS |
Collagen I (COL1A1) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | Collagen Type I from Human and Bovine Placenta |
Rabbit Polyclonal Anti-COL1A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL1A1 antibody: synthetic peptide directed towards the C terminal of human COL1A1. Synthetic peptide located within the following region: YRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMC |
COL1A1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human COL1A1 (NP_000079.2). |
| Modifications | Unmodified |
COL1A1 Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human COL1A1. |
| Modifications | Unmodified |
Collagen I alpha 1 Rabbit monoclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- COL1A1
Applications
- WB
Antibody Hosts
- Rabbit