Antibodies

View as table Download

CYB5R3 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

Rabbit polyclonal anti-CYB5R3 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CYB5R3.
Modifications Phospho-specific

Rabbit Polyclonal Anti-CYB5R3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYB5R3 antibody: synthetic peptide directed towards the C terminal of human CYB5R3. Synthetic peptide located within the following region: IRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLD

CYB5R3 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 125-334 of human CYB5R3 (NP_001165131.1).
Modifications Unmodified

Rabbit Polyclonal anti-CYB5R3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human CYB5R3

Rabbit Polyclonal anti-CYB5R3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human CYB5R3