Antibodies

Jump to Filters
View as table Download
Endothelin 2 (EDN2) Rabbit Polyclonal Antibody
TA340037

USD 375.00

5 Days

Rabbit Polyclonal Anti-EDN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EDN2 antibody: synthetic peptide directed towards the n terminal of human EDN2. Synthetic peptide located within the following region: MVSVPTTWCSVALALLVALHEGKGQAAATLEQPASSSHAQGTHLRLRRCS
Endothelin 2 (EDN2) Rabbit Polyclonal Antibody
TA349943

USD 345.00

In Stock

Rabbit Polyclonal Anti-EDN2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human EDN2