Antibodies

Jump to Filters
View as table Download
GPRC5B Rabbit Polyclonal Antibody
TA315497

USD 345.00

4 Weeks

Rabbit polyclonal anti-GPRC5B antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GPRC5B.
GPRC5B (C-term) Rabbit Polyclonal Antibody
AP51933PU-N

USD 450.00

In Stock

GPRC5B (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 292-321 amino acids from the C-terminal region of human GPRC5B
GPRC5B Rabbit Polyclonal Antibody
TA342742

USD 375.00

5 Days

Rabbit Polyclonal Anti-GPRC5B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPRC5B antibody: synthetic peptide directed towards the N terminal of human GPRC5B. Synthetic peptide located within the following region: AVAGAGALITLLLMLILLVRLPFIKEKEKKSPVGLHFLFLLGTLGLFGLT