Rabbit Polyclonal Anti-HSPB11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HSPB11 Antibody is: synthetic peptide directed towards the middle region of Human HSPB11. Synthetic peptide located within the following region: IERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAH |
Rabbit Polyclonal Anti-HSPB11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HSPB11 Antibody is: synthetic peptide directed towards the N-terminal region of Human HSPB11. Synthetic peptide located within the following region: LCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHK |
HSPB11 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HSPB11. |
Germany
Japan
United Kingdom
China