C1orf41 (HSPB11) Rabbit Polyclonal Antibody

CAT#: TA333782

Rabbit Polyclonal Anti-HSPB11 Antibody

Product Images

WB Suggested Anti-HSPB11 Antibody; Titration: 1.0 ug/ml; Positive Control: ACHN Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-HSPB11 Antibody is: synthetic peptide directed towards the middle region of Human HSPB11. Synthetic peptide located within the following region: IERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 13 kDa
• Gene Name: heat shock protein family B (small) member 11
• Database Link:
  NP_057210
  Entrez Gene 51668 Human
  UniProt ID Q9Y547
• Background: The function of this protein remains unknown.
• Synonyms: C1orf41; HSPCO34; IFT25; PP25
• Note: Immunogen sequence homology: Dog: 100%; Human: 100%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Pig: 86%; Rat: 85%; Mouse: 79%