Antibodies

Jump to Filters
View as table Download
ID2 Rabbit Polyclonal Antibody
TA321446

USD 345.00

4 Weeks

Anti-ID2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.5~9(S-P-V-R-S) derived from Human Id2.
ID2 Rabbit Polyclonal Antibody
TA330145

USD 375.00

5 Days

Rabbit Polyclonal Anti-ID2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ID2 antibody: synthetic peptide directed towards the middle region of human ID2. Synthetic peptide located within the following region: TIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALC
ID2 Rabbit Polyclonal Antibody
TA377318

USD 220.00

3 Weeks

ID2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 75-134 of human ID2 (NP_002157.2).
Modifications Unmodified