ID2 Rabbit Polyclonal Antibody

CAT#: TA330145

Rabbit Polyclonal Anti-ID2 Antibody

Product Images

WB Suggested Anti-ID2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ID2 antibody: synthetic peptide directed towards the middle region of human ID2. Synthetic peptide located within the following region: TIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 15 kDa
• Gene Name: inhibitor of DNA binding 2, HLH protein
• Database Link:
  NP_002157
  Entrez Gene 3398 Human
  UniProt ID Q02363
• Background: ID2 belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation.The protein encoded by this gene belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene has been identified for this gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: bHLHb26; GIG8; ID2A; ID2H
• Note: Immunogen sequence homology: Bovine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Pig: 92%; Chicken: 84%

Reference Data

• Protein Families: ES Cell Differentiation/IPS, Stem cell relevant signaling - TGFb/BMP signaling pathway, Transcription Factors
• Protein Pathways: TGF-beta signaling pathway