KCNQ3 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNQ3 |
KCNQ3 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNQ3 |
KCNQ3 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 650-679 amino acids from the C-terminal region of human KCNQ3 |
Rabbit polyclonal Anti-KV7.3 (KCNQ3)
Applications | WB |
Reactivities | Mouse, Rat |
Immunogen | Peptide AEGEKKEDNRYSDLKTIIC, corresponding to amino acid residues 668-686 of rat Kv7.3 . Intracellular, C-terminal. |
Rabbit Polyclonal Anti-Kcnq3 Antibody
Applications | WB |
Reactivities | Hamster, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Kcnq3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TPKHKKSQKGSAFTYPSQQSPRNEPYVARAATSETEDQSMMGKFVKVERQ |