Antibodies

View as table Download

Galectin 8 (LGALS8) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide, corresponding to amino acids 61-110 of Human Galectin-8.

Rabbit polyclonal anti-LEG8 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LEG8.

Galectin 8 (LGALS8) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide from Human LEG8.
Epitope: Internal (aa 61-110).

Rabbit Polyclonal Anti-LGALS8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LGALS8 Antibody: synthetic peptide directed towards the C terminal of human LGALS8. Synthetic peptide located within the following region: FPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGD

Galectin 8/LGALS8 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-317 of human Galectin 8/Galectin 8/LGALS8 (NP_963838.1).
Modifications Unmodified

Galectin 8/LGALS8 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-317 of human Galectin 8/Galectin 8/LGALS8 (NP_963838.1).
Modifications Unmodified