Antibodies

Jump to Filters
View as table Download
MVD Rabbit Polyclonal Antibody
TA307889

USD 415.00

In Stock

Rabbit Polyclonal antibody to MVD (mevalonate (diphospho) decarboxylase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 156 and 371 of MVD (Uniprot ID#P53602)
MVD (N-term) Rabbit Polyclonal Antibody
AP17571PU-N

USD 450.00

2 Weeks

MVD (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human MVD
MVD Rabbit Polyclonal Antibody
TA308143

USD 415.00

5 Days

Rabbit polyclonal antibody to MVD (mevalonate (diphospho) decarboxylase)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 242 of MVD (Uniprot ID#P53602)
MVD Rabbit Polyclonal Antibody
TA343105

USD 375.00

5 Days

Rabbit Polyclonal Anti-MVD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MVD antibody: synthetic peptide directed towards the N terminal of human MVD. Synthetic peptide located within the following region: VGQPRLQACLREIRCLARKRRNSRDGDPLPSSLSCKVHVASVNNFPTAAG
MVD Rabbit Polyclonal Antibody
TA378807

USD 220.00

3 Weeks

MVD Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human MVD (NP_002452.1).
Modifications Unmodified