MVD Rabbit Polyclonal Antibody

CAT#: TA343105

Rabbit Polyclonal Anti-MVD Antibody

Product Images

WB Suggested Anti-MVD Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MVD antibody: synthetic peptide directed towards the N terminal of human MVD. Synthetic peptide located within the following region: VGQPRLQACLREIRCLARKRRNSRDGDPLPSSLSCKVHVASVNNFPTAAG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: mevalonate diphosphate decarboxylase
• Database Link:
  NP_002452
  Entrez Gene 4597 Human
  UniProt ID P53602
• Background: The enzyme mevalonate pyrophosphate decarboxylase catalyzes the conversion of mevalonate pyrophosphate into isopentenyl pyrophosphate in one of the early steps in cholesterol biosynthesis. It decarboxylates and dehydrates its substrate while hydrolyzing ATP.
• Synonyms: FP17780; MDDase; MPD
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Pathways: Metabolic pathways, Terpenoid backbone biosynthesis