Antibodies

View as table Download

Rabbit Polyclonal Anti-NES Antibody - middle region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NES antibody: synthetic peptide directed towards the middle region of human NES. Synthetic peptide located within the following region: LPDSTPLGFYLRSPTSPRWDPTGEQRPPPQGETGKEGWDPAVLASEGLEA

Rabbit polyclonal Nestin Antibody (S1409)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Nestin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1389-1416 amino acids from human Nestin.

Rabbit polyclonal anti-Nestin antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a recombinant protein corresponding to amino acids 1484-1500 of human Nestin protein.

Rabbit Polyclonal Nestin Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant human nestin protein (corresponding to residues 1464-1614).

Rabbit anti-NES polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human Nestin

Nestin Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1392-1621 of human Nestin (NP_006608.1).
Modifications Unmodified