Nestin (NES) Rabbit Polyclonal Antibody

CAT#: TA344204

Rabbit Polyclonal Anti-NES Antibody - middle region

Product Images

WB Suggested Anti-NES Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: OVCAR-3 cell lysate

• 

  WB Suggested Anti-NES Antibody ; Positive Control: Lane 1: 25ug mouse NIH3T3 lysate, Lane 2: 25ug mouse embryonic stem cell lysate, Lane 3: 25ug mouse neural stem cell lysate; Primary Antibody Dilution : 1:500; Secondary Antibody : Anti-rabbit-HRP; Secondry

• 

  Heart

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NES antibody: synthetic peptide directed towards the middle region of human NES. Synthetic peptide located within the following region: LPDSTPLGFYLRSPTSPRWDPTGEQRPPPQGETGKEGWDPAVLASEGLEA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 177 kDa
• Gene Name: nestin
• Database Link:
  NP_006608
  Entrez Gene 18008 MouseEntrez Gene 10763 Human
  UniProt ID P48681
• Background: Nestin is an intermediate filament protein that was first identified with a monoclonal antibody by Hockfield and McKay (1985) [PubMed 4078630]. It is expressed predominantly in stem cells of the central nervous system in the neural tube. Upon terminal neu
• Synonyms: Nbla00170
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Horse: 86%; Dog: 79%; Bovine: 79%

Reference Data

• Protein Families: ES Cell Differentiation/IPS