Antibodies

View as table Download

Rabbit polyclonal anti-NOX5 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human NOX5.

Rabbit Polyclonal Anti-NOX5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NOX5 antibody is: synthetic peptide directed towards the C-terminal region of Human NOX5. Synthetic peptide located within the following region: DQAEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANKEKKDSITG

Rabbit Polyclonal Anti-NOX5 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human NOX5

NOX5 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human NOX5

NOX5 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 661-765 of human NOX5 (NP_078781.3).
Modifications Unmodified