NOX5 Rabbit Polyclonal Antibody

CAT#: TA338656

Rabbit Polyclonal Anti-NOX5 Antibody

Product Images

Host: Rabbit; Target Name: NOX5; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-NOX5 antibody is: synthetic peptide directed towards the C-terminal region of Human NOX5. Synthetic peptide located within the following region: DQAEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANKEKKDSITG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: NADPH oxidase, EF-hand calcium binding domain 5
• Database Link:
  NP_001171708
  Entrez Gene 79400 Human
  UniProt ID Q96PH1
• Background: This gene is predominantly expressed in the testis and lymphocyte-rich areas of spleen and lymph nodes. It encodes a calcium-dependen NADPH oxidase that generates superoxide, and functions as a calcium-dependent proton channel that may regulate redox-dependent processes in lymphocytes and spermatozoa. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
• Synonyms: MGC149776; MGC149777
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Bovine: 86%; Pig: 79%

Reference Data

• Protein Families: Ion Channels: Other, Transmembrane