Antibodies

Jump to Filters
View as table Download
Npy2r Rabbit Polyclonal Antibody
TA328897

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-Neuropeptide Y2 Receptor

Applications IF, IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide CEQRLDAIHCSEVSMTFKAK, corresponding to amino acid residues 346-364 of mouse NPY2R. Intracellular, C-terminus.
NPY2R Rabbit Polyclonal Antibody
TA314282

USD 345.00

4 Weeks

Rabbit polyclonal anti-NPY2R antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NPY2R.
NPY2R (N-term) Rabbit Polyclonal Antibody
AP52925PU-N

USD 450.00

2 Weeks

NPY2R (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 25~54 amino acids from the N-terminal region of human NPY2R
NPY2R Rabbit Polyclonal Antibody
TA329176

USD 375.00

5 Days

Rabbit Polyclonal anti-NPY2R Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NPY2R antibody is: synthetic peptide directed towards the N-terminal region of Human NPY2R. Synthetic peptide located within the following region: PIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVV
NPY2R Rabbit Polyclonal Antibody
TA379274

USD 220.00

3 Weeks

NPY2R Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human NPY2R (NP_000901.1).