NPY2R Rabbit Polyclonal Antibody

CAT#: TA329176

Rabbit Polyclonal anti-NPY2R Antibody

Product Images

Host: Rabbit; Target Name: NPY2R; Sample Tissue: Esophagus Tumor lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-NPY2R antibody is: synthetic peptide directed towards the N-terminal region of Human NPY2R. Synthetic peptide located within the following region: PIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: neuropeptide Y receptor Y2
• Database Link:
  NP_000901
  Entrez Gene 4887 Human
  UniProt ID P49146
• Background: NPY2R is a receptor for neuropeptide Y and peptide YY. The rank order of affinity of this receptor for pancreatic polypeptides is PYY > NPY > PYY (3-36) > NPY (2-36) > [Ile-31, Gln-34] PP > [Leu-31, Pro-34] NPY > PP, [Pro-34] PYY and NPY free acid.
• Synonyms: NPY2-R
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Horse: 93%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction