Antibodies

Jump to Filters
View as table Download
PEG3 Rabbit Polyclonal Antibody
TA326281

USD 345.00

In Stock

Rabbit polyclonal PEG3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PEG3.
PEG3 Rabbit Polyclonal Antibody
TA343590

USD 375.00

5 Days

Rabbit Polyclonal Anti-PEG3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PEG3 antibody: synthetic peptide directed towards the C terminal of human PEG3. Synthetic peptide located within the following region: FGECSGYIERASTSTGGANQADEKYFKCDVCGQLFNDRLSLARHQNTHTG
PEG3 Rabbit Polyclonal Antibody
TA379799

USD 220.00

3 Weeks

PEG3 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human PEG3 (NP_006201.1).
Modifications Unmodified