PEG3 Rabbit Polyclonal Antibody

CAT#: TA343590

Rabbit Polyclonal Anti-PEG3 Antibody

Product Images

WB Suggested Anti-PEG3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: A204 cell lysate; PEG3 is strongly supported by BioGPS gene expression data to be expressed in Human A204 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PEG3 antibody: synthetic peptide directed towards the C terminal of human PEG3. Synthetic peptide located within the following region: FGECSGYIERASTSTGGANQADEKYFKCDVCGQLFNDRLSLARHQNTHTG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 181 kDa
• Gene Name: paternally expressed 3
• Database Link:
  NP_006201
  Entrez Gene 5178 Human
  UniProt ID Q9GZU2
• Background: PEG3 induces apoptosis in cooperation with SIAH1A and acts as a mediator between TP53/p53 and BAX in a neuronal death pathway that is activated by DNA damage. PEG3 acts synergistically with TRAF2 and inhibits TNF induced apoptosis through activation of NF-kappa-B. PEG3 also possesses a tumor suppressing activity in glioma cells.
• Synonyms: PW1; ZKSCAN22; ZNF904; ZSCAN24
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%

Reference Data

• Protein Families: Transcription Factors