Antibodies

View as table Download

Rabbit Polyclonal Anti-PRMT3 Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRMT3 antibody: synthetic peptide directed towards the middle region of human PRMT3. Synthetic peptide located within the following region: LEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWK

Rabbit Polyclonal Anti-PRMT3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRMT3 antibody: synthetic peptide directed towards the middle region of human PRMT3. Synthetic peptide located within the following region: FSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILS

PRMT3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human PRMT3 (NP_005779.1).
Modifications Unmodified

PRMT3 Rabbit monoclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated