Rabbit Polyclonal Anti-TCFAP2C Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCFAP2C antibody: synthetic peptide directed towards the N terminal of mouse TCFAP2C. Synthetic peptide located within the following region: SASLIPHISGLEGGSVSARREVYRRSDLLLPHAHALEAGLAENLGLHEMA |
Rabbit polyclonal anti-AP2C antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AP2C. |
Rabbit Polyclonal Anti-TFAP2C Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TFAP2C Antibody: synthetic peptide directed towards the middle region of human TFAP2C. Synthetic peptide located within the following region: SPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAAHVTL |
Rabbit Polyclonal Anti-TFAP2C Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TFAP2C antibody: synthetic peptide directed towards the N terminal of human TFAP2C. Synthetic peptide located within the following region: MLWKITDNVKYEEDCEDRHDGSSNGNPRVPHLSSAGQHLYSPAPPLSHTG |
Rabbit polyclonal anti-M Tfap2c antibody (N-term)
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Mouse Tfap2c antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 123-144 amino acids from the N-terminal region of Mouse Tfap2c. |
Rabbit Polyclonal Anti-TFAP2C Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human TFAP2C |
TFAP2C Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TFAP2C |
TFAP2C Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human TFAP2C |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
