AP2 gamma (TFAP2C) Rabbit Polyclonal Antibody

CAT#: TA343379

Rabbit Polyclonal Anti-TFAP2C Antibody

Product Images

WB Suggested Anti-TFAP2C Antibody Titration: 1.25 ug/ml; Positive Control: Transfected 293T

• 

  Host: Rabbit; Target Name: TFAP2C; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0 ug/ml

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TFAP2C antibody: synthetic peptide directed towards the N terminal of human TFAP2C. Synthetic peptide located within the following region: MLWKITDNVKYEEDCEDRHDGSSNGNPRVPHLSSAGQHLYSPAPPLSHTG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: transcription factor AP-2 gamma
• Database Link:
  NP_003213
  Entrez Gene 21420 MouseEntrez Gene 7022 Human
  UniProt ID Q92754
• Background: TFAP2C is a sequence-specific DNA-binding transcription factor involved in the activation of several developmental genes. The protein can act as either a homodimer or heterodimer with other family members and is induced during retinoic acid-mediated differentiation. It plays a role in the development of the eyes, face, body wall, limbs, and neural tube.The protein encoded by this gene is a sequence-specific DNA-binding transcription factor involved in the activation of several developmental genes. The encoded protein can act as either a homodimer or heterodimer with other family members and is induced during retinoic acid-mediated differentiation. It plays a role in the development of the eyes, face, body wall, limbs, and neural tube.
• Synonyms: AP2-GAMMA; ERF1; hAP-2g; TFAP2G
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 79%; Horse: 75%; Guinea pig: 75%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors