Rabbit polyclonal Anti-TMPRSS4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS4 antibody: synthetic peptide directed towards the N terminal of human TMPRSS4. Synthetic peptide located within the following region: IPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSAT |
Rabbit polyclonal Anti-TMPRSS4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS4 antibody: synthetic peptide directed towards the middle region of human TMPRSS4. Synthetic peptide located within the following region: LSGSLVSLHCLACGKSLKTPRVVGGEEASVDSWPWQVSIQYDKQHVCGGS |
Rabbit Polyclonal Anti-TMPRSS4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TMPRSS4 |
TMPRSS4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 70-270 of human TMPRSS4 (NP_063947.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China