TMPRSS4 Rabbit Polyclonal Antibody

CAT#: TA331094

Rabbit polyclonal Anti-TMPRSS4 Antibody

Product Images

WB Suggested Anti-TMPRSS4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMPRSS4 antibody: synthetic peptide directed towards the N terminal of human TMPRSS4. Synthetic peptide located within the following region: IPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSAT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: transmembrane protease, serine 4
• Database Link:
  NP_001077416
  Entrez Gene 56649 Human
  UniProt ID Q9NRS4
• Background: This gene encodes a member of the serine protease family. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified as a gene overexpressed in pancreatic carcinoma. The encoded protein is membrane bound with a N-terminal anchor sequence and a glycosylated extracellular region containing the serine protease domain. Multiple transcript variants encoding different isoforms have been found for this gene.
• Synonyms: CAPH2; MT-SP2; TMPRSS3
• Note: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 92%; Pig: 92%; Guinea pig: 92%; Bovine: 85%; Rabbit: 85%

Reference Data

• Protein Families: Druggable Genome, Protease, Transmembrane