Antibodies

View as table Download

Rabbit Polyclonal Anti-TNFRSF9 Antibody

Applications WB
Reactivities Canine, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFRSF9 antibody: synthetic peptide directed towards the C terminal of human TNFRSF9. Synthetic peptide located within the following region: LTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL

4-1BB/CD137 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human 4-1BB/CD137 (NP_001552.2).
Modifications Unmodified