CD137 (TNFRSF9) Rabbit Polyclonal Antibody

CAT#: TA343047

Rabbit Polyclonal Anti-TNFRSF9 Antibody

Product Images

Lanes: Lane 1: 40ug whole canine retina; Primary Antibody Dilution: 1:1000; Secondary Antibody: Goat anti-rabbit-HRP; Secondary Antibody Dilution: 1:5000; Gene Name: TNFRSF; Submitted by: Dr. Stefania Marsili and Dr. William Beltran, University of Pennsyl

• 

  WB Suggested Anti-TNFRSF9 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Canine, Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TNFRSF9 antibody: synthetic peptide directed towards the C terminal of human TNFRSF9. Synthetic peptide located within the following region: LTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: tumor necrosis factor receptor superfamily member 9
• Database Link:
  NP_001552
  Entrez Gene 3604 Human
  UniProt ID Q07011
• Background: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contributes to the clonal expansion, survival, and development of T cells. It can also induce proliferation in peripheral monocytes, enhance T cell apoptosis induced by TCR/CD3 triggered activation, and regulate CD28 co-stimulation to promote Th1 cell responses. The expression of this receptor is induced by lymphocyte activation. TRAF adaptor proteins have been shown to bind to this receptor and transduce the signals leading to activation of NF-kappaB.
• Synonyms: 4-1BB; CD137; CDw137; ILA
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Bovine: 86%; Pig: 85%; Horse: 85%; Rat: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Cytokine-cytokine receptor interaction