Antibodies

Jump to Filters
View as table Download
FOXD2 Rabbit Polyclonal Antibody
TA341796

USD 375.00

In Stock

Rabbit Polyclonal Anti-Foxd2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Foxd2 antibody: synthetic peptide directed towards the c terminal of mouse Foxd2. Synthetic peptide located within the following region: GPGGQAQVLAMLTAPALTPVAGHIRLSHPGDSLLSSGPSFASKVAGLSGC
FOXD2 Rabbit Polyclonal Antibody
TA322739

USD 345.00

In Stock

Anti-FOXD2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 8-22 amino acids of Human forkhead box D2
FOXD2 Rabbit Polyclonal Antibody
TA322740

USD 345.00

In Stock

Anti-FOXD2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 9-22 amino acids of Human forkhead box D2