FOXD2 Rabbit Polyclonal Antibody

CAT#: TA341796

Rabbit Polyclonal Anti-Foxd2 Antibody


USD 375.00

In Stock*

Size
    • 100 ul

Product Images

Other products for "FOXD2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Foxd2 antibody: synthetic peptide directed towards the c terminal of mouse Foxd2. Synthetic peptide located within the following region: GPGGQAQVLAMLTAPALTPVAGHIRLSHPGDSLLSSGPSFASKVAGLSGC
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 49
Gene Name forkhead box D2
Background Foxd2 is a probable transcription factor involved in embryogenesis and somatogenesis.
Synonyms FKHL17; FREAC-9; FREAC9
Note Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Pig: 86%; Bovine: 86%; Guinea pig: 86%; Horse: 79%; Human: 79%
Reference Data
Protein Families Druggable Genome, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.