Antibodies

View as table Download

Rabbit Polyclonal Anti-Foxd2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Foxd2 antibody: synthetic peptide directed towards the c terminal of mouse Foxd2. Synthetic peptide located within the following region: GPGGQAQVLAMLTAPALTPVAGHIRLSHPGDSLLSSGPSFASKVAGLSGC

Rabbit Polyclonal anti-FOXD2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXD2 antibody: synthetic peptide directed towards the N terminal of human FOXD2. Synthetic peptide located within the following region: LPARSGPRAPRDVLPHGHEPPAEEAEADLAEDEEESGGCSDGEPRALASR

Anti-FOXD2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 8-22 amino acids of Human forkhead box D2

Anti-FOXD2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 9-22 amino acids of Human forkhead box D2