Antibodies

Jump to Filters
View as table Download
DNMT1 Rabbit Monoclonal Antibody [Clone ID: EPR3521(2)]
TA307586

USD 516.00

In Stock

Rabbit monoclonal antibody against Dnmt1(clone EPR3521(2))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
S adenosylhomocysteine hydrolase (AHCY) Rabbit Polyclonal Antibody
TA332593

USD 275.00

In Stock

Rabbit anti-AHCY Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human AHCY
DNMT3A Rabbit Polyclonal Antibody
TA346818

USD 475.00

5 Days

Rabbit Polyclonal Anti-DNMT3A Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-DNMT3A antibody is: synthetic peptide directed towards the C-terminal region of Human DNMT3A. Synthetic peptide located within the following region: STVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKE